Products
Explore our selection of amplification and labeling reagents, peptides, proteins, and more. Find also antibodies, assay kits, and other tools for your lab.
101 - 120 of 2054
SensoLyte® Anti-Human MOG (1-125) Human IgG Specific ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55153-H
SensoLyte® Anti-PLP (139-151) IgG Quantitative ELISA Kit (mouse) Colorimetric - 1 kit
- Cat.Number : AS-55524
SensoLyte® Anti-Rat MOG (1-125) IgG Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55157
SensoLyte® Anti-PLP (178-191) IgG Quantitative ELISA Kit (mouse) Colorimetric - 1 kit
- Cat.Number : AS-55523
SensoLyte® Anti-Mouse/Rat ß-Amyloid (1-42) Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55554
SensoLyte® Anti-Mouse/Rat ß-Amyloid (1-40) Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55553
Beta-Amyloid (2-40) - 1 mg
- AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat.Number : AS-29905-1
Tyrosine Kinase Peptide 1 [KVEKIGEGTYGVVYK], 5-TMR labeled - 1 mg
- 5-TMR-KVEKIGEGTYGVVYK
- Cat.Number : AS-29935-1
MBP, MAPK Substrate, Biotinylated, Phosphorylated [Biotin-APR-pT-PGGRR] - 1 mg
- Biotin-APR-pT-PGGRR
- Cat.Number : AS-29877
EGF Receptor Substrate 2 [DADE-pY-LIPQQG], 5-FAM labeled - 5 mg
- 5-FAM-DADE-pY-LIPQQG
- Cat.Number : AS-29971-5
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ] - 1 mg
- ADEYLIPQQ
- Cat.Number : AS-29942-1
EGF Receptor Substrate 2 [DADE-pY-LIPQQG], Biotinylated - 1 mg
- Biotin-DADE-pY-LIPQQG
- Cat.Number : AS-29972-1
[Pyr11]-beta-Amyloid (11-40) - 1 mg
- Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat.Number : AS-29904-1
101 - 120 of 2054