Tube of Exendin-4 peptide
Peptides

Exendin 4

€290.00
Check your price
  • Cat.Number : AS-24463
  • Availability :
    In stock

Size

Alternative choices

Quantity

Add to wishlist

Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.

Specifications

Chemistry
Sequence one letter code
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence three letter code
  • H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
CAS registry number
  • 141758-74-9
Molecular Formula
  • C184H282N50O60S
Molecular Mass/ Weight
  • 4186.8
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • Gila
Codes
Code Nacres
  • NA.26

Downloads

You may also be interested in the following product(s)

Tube of GIP peptide, rat

GIP, rat

Cat.Number : AS-65568-05
€230.00 Excl. Tax
Tube of GLP-1 (7-36) peptide

Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human, mouse, rat, bovine, guinea pig

Cat.Number : AS-22462
€200.00 Excl. Tax
Image of a kit SensoLyte 520 IDE Activity Assay Kit Fluorimetric

SensoLyte® 520 IDE Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72231
€637.00 Excl. Tax

Citations

Colesevelam suppresses hepatic glycogenolysis by TGR5-mediated induction of GLP-1 action in DIO mice.

Am J Physiol Gastrointest Liver Physiol . 2012 Dec 20 ; 304(4) G371 | DOI : 10.​1152/​ajpgi.​00400.​2012.

  • MJ. Potthoff
  • et al

Pax6 haploinsufficiency causes abnormal metabolic homeostasis by down-regulating GLP-1 in mice.

Endocrin . 2008 Dec 30 ; 150(5) 2136 | DOI : 10.1210/en.2008-1006.

  • J. Ding

Mesenchymal Cells Appearing in Pancreatic Tissue Culture Are Bone Marrow-Derived Stem Cells With the Capacity to Improve Transplanted Islet Function.

Stemm Cells . 2010 Jan 01 ; 28(1) 140 | DOI : 10.1002/stem.259

  • V. Sordi
  • et al

Exendin-4 treatment improves metabolic control after rat islet transplantation to athymic mice with streptozotocin-induced diabetes.

Diabetologia . 2006 Apr 12 ; 49(6) 1247 | DOI : 10.1007/s00125-006-0251-2

  • A. Sharma
  • et al

A glucagon-like peptide-1 analog liraglutide suppresses macrophage foam cell formation and atherosclerosis.

Peptides . 2014 Jan 10 ; 54 19 | DOI : 10.1016/j.peptides.2013.12.015

  • Y. Tashiro
  • et al