Products
Explore our selection of amplification and labeling reagents, peptides, proteins, and more. Find also antibodies, assay kits, and other tools for your lab.
141 - 160 of 2091
SensoLyte® Anti-Mouse/Rat ß-Amyloid (1-40) Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55553
Amylin (1-37), Islet Amyloid Polypeptide, IAPP, human, amide - 1 mg
- KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge: 2-7)
- Cat.Number : AS-60254-1
HNP-1, a-Defensin-1, Human Neutrophil Peptide-1 - 0.1 mg
- ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
- Cat.Number : AS-60743
Chlorotoxin (Cltx) - 0.1 mg
- MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
- Cat.Number : AS-60770
Angiotensin I Converting Enzyme 2, (ACE-2) Substrate - 1 mg
- Mca-APK(Dnp)
- Cat.Number : AS-60757
141 - 160 of 2091