Catalog
A huge collection of high purity peptides for different research areas such as Diabetes, Cardiovascular, Cell Permeable and Penetrating Peptides, etc.
761 - 780 of 1093
Protease-Activated Receptor-3, PAR-3 (1-6), human - 1 mg
- TFRGAP-NH2
- Cat.Number : AS-62657
MBP (85-106) guinea pig, MBP (86-107), human - 1 mg
- VVHFFKNIVTPRTPPPSQGKGR
- Cat.Number : AS-62739
Atrial Natriuretic Peptide (4-18), rat - 1 mg
- RSSCFGGRIDRIGAC-NH2 (Disulfide bridge 4-15)
- Cat.Number : AS-62839
Elafin - 0.1 mg
- AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
- Cat.Number : AS-61641
761 - 780 of 1093