Tube of Beta-Amyloid (1-40) HL488 peptide
Peptides

Beta-Amyloid (1-40), HiLyte™ Fluor 488-labeled - 0.1 mg

€300.00
Check your price
  • Cat.Number : AS-60491-01
  • Availability :
    In stock

Alternative choices

Quantity

Add to wishlist

Beta-Amyloid (1-40) together with beta-Amyloid (1-42) are two major C-terminal variants of the beta-Amyloid protein. These beta-Amyloid peptides undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This is a fluorescent (HiLyte™ Fluor 488)-labeled ß-Amyloid peptide, Abs/Em=503/528 nm.

503/528

Specifications

Chemistry
Sequence one letter code
  • HiLyte Fluor™ 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • Hilyte™ Fluor 488-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Molecular Mass/ Weight
  • 4686,3
Properties
Absorbance (nm)
  • 503
Emission (nm)
  • 528
Modification
Conjugation type
  • Fluorescent dyes
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C Protected from light
Activity
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

Downloads

You may also be interested in the following product(s)

Tube AggreSure Beta-Amyloid (1-40), human - 0.25 mg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
€330.00 Excl. Tax
Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
€341.00 Excl. Tax
Image of a kit SensoLyte Anti-Mouse/Rat Beta-Amyloid (1-40) Quantitative ELISA Kit Colorimetric

SensoLyte® Anti-Mouse/Rat ß-Amyloid (1-40) Quantitative ELISA Kit Colorimetric - 1 kit

Cat.Number : AS-55553
€594.00 Excl. Tax

Citations

Microglia constitute a barrier that prevents neurotoxic protofibrillar ​Aβ42 hotspots around plaques

Nat Commun. . 2015 Jan 29 ; 6 6176 | DOI : 10.1038/ncomms7176

  • C. Condello
  • et al

Prenatal high‐fat diet alters the cerebrovasculature and clearance of β‐amyloid in adult offspring

J Pathol . 2014 Oct 24 ; 235(4) 619 | DOI : https://doi.org/10.1002/path.4468

  • CA. Hawkes
  • et al

Lysosomal sorting of Amyloid-β by the SORLA Receptor is impaired by a familial Alzheimer’s Disease mutation

Sci Transl Med . 2014 Feb 12 ; 6(223) 223ra20 | DOI : 10.1126/scitranslmed.3007747

  • S. Caglayan
  • et al

The Pro-Neurotrophin Receptor Sortilin Is a Major Neuronal Apolipoprotein E Receptor for Catabolism of Amyloid-β Peptide in the Brain

J Neurosci . 2013 Jan 02 ; 33(1) 358 | DOI : https://doi.org/10.1523/JNEUROSCI.2425-12.2013

  • A-S. Carlo
  • et al

Identification of BACE2 as an avid ß-amyloid-degrading protease

Mol Neurodegener . 2012 Sep 17 ; 7 46 | DOI : 10.1186/1750-1326-7-46

  • SO. Abdul-Hay
  • et al

Transmission electron microscopy characterization of fluorescently labelled amyloid β 1-40 and α-synuclein aggregates

BMC Biotechnol . 2011 Dec 19 ; 11 125 | DOI : 10.1186/1472-6750-11-125

  • VL. Anderson
  • WW. Webb

Biomimetic Microdroplet Membrane Interface: Detection of the Lateral Localization of Amyloid Beta Peptides

J Phys Chem Lett . 2009 Nov 12 ; 1 170 | DOI : https://doi.org/10.1021/jz900106z

  • T. Hamada
  • et al

Determination of the Oligomer Size of Amyloidogenic Protein β-Amyloid(1–40) by Single-Molecule Spectroscopy

Biophys J. . 2009 Aug 01 ; 97(3) 912 | DOI : 10.1016/j.bpj.2009.05.035

  • H. Ding
  • et al

Plug-Based Microfluidics with Defined Surface Chemistry to Miniaturize and Control Aggregation of Amyloidogenic Peptides

Angew Chem Int Ed Engl . 2009 Apr 30 ; 48(8) 1487 | DOI : 10.1002/anie.200805225

  • M. Meier
  • et al

Real-time observation of model membrane dynamics induced by Alzheimer's amyloid beta

Biophys Chem . 2010 Mar 01 ; 147(1-2) 81 | DOI : https://doi.org/10.1016/j.bpc.2009.12.004

  • M. Morita
  • et al

Direct Observations of Amyloid β Self-Assembly in Live Cells Provide Insights into Differences in the Kinetics of Aβ(1–40) and Aβ(1–42) Aggregation

Chem Biol. . 2014 Jun 19 ; 21(6) 732 | DOI : 10.1016/j.chembiol.2014.03.014

  • EK. Esbjörner
  • et al

Rare Individual Amyloid-β Oligomers Act on Astrocytes to Initiate Neuronal Damage

Biochemistry. . 2014 Apr 09 ; 53(15) 2442 | DOI : 10.1021/bi401606f

  • P. Narayan
  • et al

Direct Observations of Amyloid β Self-Assembly in Live Cells Provide Insights into Differences in the Kinetics of Aβ (1–40) and Aβ (1–42) Aggregation.

Chem Biol . 2014 Jun 19 ; 21(6) 732 | DOI : 10.1016/j.chembiol.2014.03.014

  • EK. Esbjörner