Peptides

PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat - 0.5 mg

486.00
Check your price
  • Cat.Number : AS-23648
  • Availability :
    In stock

Quantity

This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.

Specifications

Chemistry
Sequence one letter code
  • HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
Sequence three letter code
  • H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-Lys(Biotin)-NH2
Molecular Mass/ Weight
  • 4888.8
Modification
Conjugation type
  • Biotins
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human, ovine, rat
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of (Arg8)-Vasopressin (AVP) peptide

[Arg8]-Vasopressin (AVP) Peptide

Cat.Number : AS-24289
50.00 Excl. Tax
Tube of ACTH (1-39) peptide, human

ACTH (1-39), human

Cat.Number : AS-20611
263.00 Excl. Tax
Tube of Oxytocin peptide

Oxytocin Peptide

Cat.Number : AS-24275
95.00 Excl. Tax