Products

Explore our selection of amplification and labeling reagents, peptides, proteins, and more. Find also antibodies, assay kits, and other tools for your lab.

    261 - 280 of 2091

    390 MMP FRET Substrate 2 - 5 mg

    • Mca-PLGL-Dap(Dnp)-AR
    • Cat.Number : AS-27079

    PKCe Peptide Substrate - 1 mg

    • ERMRPRKRQGSVRRRV
    • Cat.Number : AS-27183

    390 MMP Substrate XIII, NFF-3 - 1 mg

    • Mca-RPKPVE-Nva-WR-K(Dnp)-NH2
    • Cat.Number : AS-27114

    Neurogranin 28-43 [AAKIQASFRGHMARKK], Biotin-LC - 5 mg

    • Biotin-LC-AAKIQASFRGHMARKK
    • Cat.Number : AS-27176

    390 MMP FRET Substrate XI - 5 mg

    • Mca-P-Cha-G-Nva-HA-Dap(Dnp)-NH2
    • Cat.Number : AS-27109

    Beta-Amyloid (2-40) - 1 mg

    • AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-29905-1

    PLP (139-151) C140S - 1 mg

    • HSLGKWLGHPDKF
    • Cat.Number : AS-29213

    RGD-4C - 5 mg

    • ACDCRGDCFCG (Disulfide bridge: 2-10 and 4-8)
    • Cat.Number : AS-29898
      261 - 280 of 2091