Catalog
A huge collection of high purity peptides for different research areas such as Diabetes, Cardiovascular, Cell Permeable and Penetrating Peptides, etc.
381 - 400 of 1093
Thrombospondin (TSP-1) Inhibitor scrambled peptide, SLLK - 1 mg
- SLLK-NH2
- Cat.Number : AS-60875
Elafin - 0.1 mg
- AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
- Cat.Number : AS-61641
381 - 400 of 1093