Peptide Enzyme Substrates

Discover our comprehensive portfolio of peptide enzyme substrates including non-fluorescent, blue, green, yellow and orange fluorogenic and FRET peptide.

    81 - 100 of 115

    Syk Kinase Peptide Substrate - 1 mg

    • KEDPDYEWPSAK-NH2
    • Cat.Number : AS-64141

    Enterokinase Substrate - 1 mg

    • GDDDDK-ßNA
    • Cat.Number : AS-62974

    Thrombin Substrate S2238 1 mg

    • f-Pip-R-pNA
    • Cat.Number : AS-63776

    Syk Kinase Peptide Substrate, Biotin labeled - 1 mg

    • Biotin-KEDPDYEWPSAK-NH2
    • Cat.Number : AS-64140

    S6 Kinase Substrate (229-239)

    • AKRRRLSSLRA
    • Cat.Number : AS-27191

    MMP Colorimetric Substrate - 1 mg

    • Ac-PLG-SCH[CH2CH(CH3)2]-CO-LG-OC2H5
    • Cat.Number : AS-27096

    390 MMP FRET Substrate 1 - 1 mg

    • Mca-PLGL-Dap(Dnp)-AR-NH2
    • Cat.Number : AS-27076

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01

    HCV Protease FRET Substrate (RET S1)

    • Ac-DE-D(Edans)-EE-Abu-ψ-[COO]-AS-K(Dabcyl)-NH2
    • Cat.Number : AS-22991
      81 - 100 of 115