Peptides

AggreSure ß-Amyloid (1-40), human - 0.25 mg

330.00
Check your price
  • Cat.Number : AS-72215
  • Availability :
    In stock
  • Shipping conditions : Ice delivery fees must be applied

Alternative choices

Quantity

AggreSure beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using SensoLyte® ThT Aβ40 Aggregation kit (Cat# AS-72213). Aggregation is guaranteed. The quantity is 0.25mg net peptide.

Alzheimer's Disease (AD) is the most common neurodegenerative disorder in elderly people. It has been demonstrated that AD has biological causes and is characterized by the presence of senile plaques and neurofibrillary tangles mainly in cerebral cortex and hippocampus brain regions. Beta-Amyloid (1-40) (Aβ40) and beta-Amyloid (1-42) (Aβ42) are the main components of the above plaques; however, other forms of beta-Amyloid peptides are also present. Both peptides are cleaved from the Amyloid Precursor Protein (APP) by β-secretase and ?-secretase enzymes. Many studies suggest that Aβ42 or/and Aβ43 are required to initiate formation of amyloid plaques and neurofibrills that leads to the neurodegeneration, while Aβ40 is less neurotoxic.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 131438-79-4
UniProt number
  • P05067
Molecular Formula
  • C194H295N53O58S
Molecular Mass/ Weight
  • 4330.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Resuspension condition
  • Reconstitute peptide in either 50mM Tris/150mM NaCl (pH 7.2) or 20mM HEPES/150mM NaCl (pH 7.2) at 0.25 mg/ml. Use water bath sonicator to completely dissolve peptide if necessary. Do not vortex!
Storage Conditions
  • Store at -20°C. Do not freeze-thaw reconstituted peptide.
Activity
Application
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Beta-Amyloid (1-40) peptide

Beta-Amyloid (1-40) Peptide

Cat.Number : AS-24235-
161.00 Excl. Tax
Image of a kit SensoLyte Thioflavin T Beta-Amyloid (1-40) Aggregation Kit

SensoLyte® Thioflavin T ß-Amyloid (1-40) Aggregation Kit - 1 kit

Cat.Number : AS-72213
621.00 Excl. Tax

Citations

Enantiomeric Aβ peptides inhibit the fluid shear stress response of PIEZO1

Nature . 2018 Sep 24 ; 8 14267 | DOI : 10.1038/s41598-018-32572-2

  • MM. Maneshi
  • et al

Aβ40 Reduces P-Glycoprotein at the Blood-Brain Barrier through the Ubiquitin-Proteasome Pathway.

J Neurosci. . 2016 Feb 01 ; 36(6) 1930 | DOI : 10.1523/JNEUROSCI.0350-15.2016

  • AM. Hartz
  • et al

Effects of Melatonin and Beta-Amyloid on Mitochondrial Function in a Model of Aging Mouse Astrocytes. 

FASEB J . 2016 Apr 18 ; 702,1

  • EK. Debner
  • JM. King